Brand: | Abnova |
Reference: | H00029128-M01 |
Product name: | UHRF1 monoclonal antibody (M01), clone 3A11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant UHRF1. |
Clone: | 3A11 |
Isotype: | IgG1 Kappa |
Gene id: | 29128 |
Gene name: | UHRF1 |
Gene alias: | FLJ21925|ICBP90|MGC138707|Np95|RNF106|hNP95 |
Gene description: | ubiquitin-like with PHD and ring finger domains 1 |
Genbank accession: | NM_013282 |
Immunogen: | UHRF1 (NP_037414, 694 a.a. ~ 793 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | WNEVLASLKDRPASGSPFQLFLSKVEETFQCICCQELVFRPITTVCQHNVCKDCLDRSFRAQVFSCPACRYDLGRSYAMQVNQPLQTVLNQLFPGYGNGR |
Protein accession: | NP_037414 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | UHRF1 monoclonal antibody (M01), clone 3A11 Western Blot analysis of UHRF1 expression in Hela S3 NE ( Cat # L013V3 ). |
Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Interplay between Np95 and Eme1 in the DNA damage response.Mistry H, Gibson L, Yun JW, Sarras H, Tamblyn L, McPherson JP. Biochem Biophys Res Commun. 2008 Oct 24;375(3):321-5. Epub 2008 Aug 8. |