UHRF1 monoclonal antibody (M01), clone 3A11 View larger

UHRF1 monoclonal antibody (M01), clone 3A11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of UHRF1 monoclonal antibody (M01), clone 3A11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IF,S-ELISA,ELISA,WB-Re

More info about UHRF1 monoclonal antibody (M01), clone 3A11

Brand: Abnova
Reference: H00029128-M01
Product name: UHRF1 monoclonal antibody (M01), clone 3A11
Product description: Mouse monoclonal antibody raised against a partial recombinant UHRF1.
Clone: 3A11
Isotype: IgG1 Kappa
Gene id: 29128
Gene name: UHRF1
Gene alias: FLJ21925|ICBP90|MGC138707|Np95|RNF106|hNP95
Gene description: ubiquitin-like with PHD and ring finger domains 1
Genbank accession: NM_013282
Immunogen: UHRF1 (NP_037414, 694 a.a. ~ 793 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: WNEVLASLKDRPASGSPFQLFLSKVEETFQCICCQELVFRPITTVCQHNVCKDCLDRSFRAQVFSCPACRYDLGRSYAMQVNQPLQTVLNQLFPGYGNGR
Protein accession: NP_037414
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00029128-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00029128-M01-1-25-1.jpg
Application image note: UHRF1 monoclonal antibody (M01), clone 3A11 Western Blot analysis of UHRF1 expression in Hela S3 NE ( Cat # L013V3 ).
Applications: WB-Ce,IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Interplay between Np95 and Eme1 in the DNA damage response.Mistry H, Gibson L, Yun JW, Sarras H, Tamblyn L, McPherson JP.
Biochem Biophys Res Commun. 2008 Oct 24;375(3):321-5. Epub 2008 Aug 8.

Reviews

Buy UHRF1 monoclonal antibody (M01), clone 3A11 now

Add to cart