RACGAP1 monoclonal antibody (M03), clone 4B7 View larger

RACGAP1 monoclonal antibody (M03), clone 4B7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RACGAP1 monoclonal antibody (M03), clone 4B7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about RACGAP1 monoclonal antibody (M03), clone 4B7

Brand: Abnova
Reference: H00029127-M03
Product name: RACGAP1 monoclonal antibody (M03), clone 4B7
Product description: Mouse monoclonal antibody raised against a partial recombinant RACGAP1.
Clone: 4B7
Isotype: IgG2b Kappa
Gene id: 29127
Gene name: RACGAP1
Gene alias: HsCYK-4|ID-GAP|MgcRacGAP
Gene description: Rac GTPase activating protein 1
Genbank accession: BC032754
Immunogen: RACGAP1 (AAH32754, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MDTMMLNVRNLFEQLVRRVEILSEGNEVQFIQLAKDFEDFRKKWQRTDHELGKYKDLLMKAETERSALDVKLKHARNQVDVEIKRRQRAEADCEKLERQIQLIREMLMCD
Protein accession: AAH32754
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00029127-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.73 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy RACGAP1 monoclonal antibody (M03), clone 4B7 now

Add to cart