Brand: | Abnova |
Reference: | H00029127-M01 |
Product name: | RACGAP1 monoclonal antibody (M01), clone 1G6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant RACGAP1. |
Clone: | 1G6 |
Isotype: | IgG2b Kappa |
Gene id: | 29127 |
Gene name: | RACGAP1 |
Gene alias: | HsCYK-4|ID-GAP|MgcRacGAP |
Gene description: | Rac GTPase activating protein 1 |
Genbank accession: | BC032754 |
Immunogen: | RACGAP1 (AAH32754, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MDTMMLNVRNLFEQLVRRVEILSEGNEVQFIQLAKDFEDFRKKWQRTDHELGKYKDLLMKAETERSALDVKLKHARNQVDVEIKRRQRAEADCEKLERQIQLIREMLMCD |
Protein accession: | AAH32754 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged RACGAP1 is approximately 0.3ng/ml as a capture antibody. |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | RNA-seq identification of RACGAP1 as a metastatic driver in uterine carcinosarcoma.Mi S, Lin M, Brouwer-Visser J, Heim J, Smotkin D, Hebert TM, Gunter MJ, Goldberg GL, Zheng D, Huang GS. Clin Cancer Res. 2016 Apr 27. [Epub ahead of print] |