RACGAP1 monoclonal antibody (M01), clone 1G6 View larger

RACGAP1 monoclonal antibody (M01), clone 1G6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RACGAP1 monoclonal antibody (M01), clone 1G6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about RACGAP1 monoclonal antibody (M01), clone 1G6

Brand: Abnova
Reference: H00029127-M01
Product name: RACGAP1 monoclonal antibody (M01), clone 1G6
Product description: Mouse monoclonal antibody raised against a partial recombinant RACGAP1.
Clone: 1G6
Isotype: IgG2b Kappa
Gene id: 29127
Gene name: RACGAP1
Gene alias: HsCYK-4|ID-GAP|MgcRacGAP
Gene description: Rac GTPase activating protein 1
Genbank accession: BC032754
Immunogen: RACGAP1 (AAH32754, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MDTMMLNVRNLFEQLVRRVEILSEGNEVQFIQLAKDFEDFRKKWQRTDHELGKYKDLLMKAETERSALDVKLKHARNQVDVEIKRRQRAEADCEKLERQIQLIREMLMCD
Protein accession: AAH32754
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00029127-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.73 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00029127-M01-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged RACGAP1 is approximately 0.3ng/ml as a capture antibody.
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: RNA-seq identification of RACGAP1 as a metastatic driver in uterine carcinosarcoma.Mi S, Lin M, Brouwer-Visser J, Heim J, Smotkin D, Hebert TM, Gunter MJ, Goldberg GL, Zheng D, Huang GS.
Clin Cancer Res. 2016 Apr 27. [Epub ahead of print]

Reviews

Buy RACGAP1 monoclonal antibody (M01), clone 1G6 now

Add to cart