CD274 monoclonal antibody (M04), clone 2E6 View larger

CD274 monoclonal antibody (M04), clone 2E6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CD274 monoclonal antibody (M04), clone 2E6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about CD274 monoclonal antibody (M04), clone 2E6

Brand: Abnova
Reference: H00029126-M04
Product name: CD274 monoclonal antibody (M04), clone 2E6
Product description: Mouse monoclonal antibody raised against a partial recombinant CD274.
Clone: 2E6
Isotype: IgG2b Kappa
Gene id: 29126
Gene name: CD274
Gene alias: B7-H|B7H1|MGC142294|MGC142296|PD-L1|PDCD1L1|PDCD1LG1|PDL1
Gene description: CD274 molecule
Genbank accession: BC074984.2
Immunogen: CD274 (AAH74984.1, 18 a.a. ~ 238 a.a) partial recombinant protein.
Immunogen sequence/protein sequence: AFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNER
Protein accession: AAH74984.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00029126-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (26.51 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CD274 monoclonal antibody (M04), clone 2E6 now

Add to cart