Brand: | Abnova |
Reference: | H00029126-M03 |
Product name: | CD274 monoclonal antibody (M03), clone 3D2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CD274. |
Clone: | 3D2 |
Isotype: | IgG2b Kappa |
Gene id: | 29126 |
Gene name: | CD274 |
Gene alias: | B7-H|B7H1|MGC142294|MGC142296|PD-L1|PDCD1L1|PDCD1LG1|PDL1 |
Gene description: | CD274 molecule |
Genbank accession: | BC074984.2 |
Immunogen: | CD274 (AAH74984.1, 18 a.a. ~ 238 a.a) partial recombinant protein. |
Immunogen sequence/protein sequence: | AFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNER |
Protein accession: | AAH74984.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (26.51 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |