Cart 96 Product Products 37 639,21 € (empty)
No products
To be determined Shipping
37 639,21 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 96 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 37 639,21 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 37 639,21 €
Data sheet of LGALS13 purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Tr |
More info about LGALS13 purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00029124-B01P |
| Product name: | LGALS13 purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human LGALS13 protein. |
| Gene id: | 29124 |
| Gene name: | LGALS13 |
| Gene alias: | GAL13|PLAC8|PP13 |
| Gene description: | lectin, galactoside-binding, soluble, 13 |
| Genbank accession: | NM_013268.2 |
| Immunogen: | LGALS13 (AAH66304.1, 1 a.a. ~ 139 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MSSLPVPYKLPVSLSVGSCVIIKGTPIHSFINDPQLQVDFYTDMDEDSDIAFRFRVHFGNHVVMNRREFGIWMLEETTDYVPFEDGKQFELCIYVHYNEYEIKVNGIRIYGFVHRIPPSFVKMVQVSRDISLTSVCVCN |
| Protein accession: | AAH66304.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of LGALS13 expression in transfected 293T cell line (H00029124-T01) by LGALS13 MaxPab polyclonal antibody. Lane1:LGALS13 transfected lysate(15.29 KDa). Lane2:Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |