Brand: | Abnova |
Reference: | H00029122-M10 |
Product name: | TSP50 monoclonal antibody (M10), clone 2D8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TSP50. |
Clone: | 2D8 |
Isotype: | IgG2a Kappa |
Gene id: | 29122 |
Gene name: | TSP50 |
Gene alias: | - |
Gene description: | testes-specific protease 50 |
Genbank accession: | NM_013270 |
Immunogen: | TSP50 (NP_037402.1, 214 a.a. ~ 313 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | QELKYSNYVRPICLPGTDYVLKDHSRCTVTGWGLSKADGMWPQFRTIQEKEVIILNNKECDNFYHNFTKIPTLVQIIKSQMMCAEDTHREKFCYELTGEP |
Protein accession: | NP_037402.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged TSP50 is 0.3 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |