TSP50 monoclonal antibody (M10), clone 2D8 View larger

TSP50 monoclonal antibody (M10), clone 2D8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TSP50 monoclonal antibody (M10), clone 2D8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about TSP50 monoclonal antibody (M10), clone 2D8

Brand: Abnova
Reference: H00029122-M10
Product name: TSP50 monoclonal antibody (M10), clone 2D8
Product description: Mouse monoclonal antibody raised against a partial recombinant TSP50.
Clone: 2D8
Isotype: IgG2a Kappa
Gene id: 29122
Gene name: TSP50
Gene alias: -
Gene description: testes-specific protease 50
Genbank accession: NM_013270
Immunogen: TSP50 (NP_037402.1, 214 a.a. ~ 313 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: QELKYSNYVRPICLPGTDYVLKDHSRCTVTGWGLSKADGMWPQFRTIQEKEVIILNNKECDNFYHNFTKIPTLVQIIKSQMMCAEDTHREKFCYELTGEP
Protein accession: NP_037402.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00029122-M10-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged TSP50 is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy TSP50 monoclonal antibody (M10), clone 2D8 now

Add to cart