CLEC2D monoclonal antibody (M03), clone 2E11 View larger

CLEC2D monoclonal antibody (M03), clone 2E11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CLEC2D monoclonal antibody (M03), clone 2E11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about CLEC2D monoclonal antibody (M03), clone 2E11

Brand: Abnova
Reference: H00029121-M03
Product name: CLEC2D monoclonal antibody (M03), clone 2E11
Product description: Mouse monoclonal antibody raised against a full-length recombinant CLEC2D.
Clone: 2E11
Isotype: IgG2a Kappa
Gene id: 29121
Gene name: CLEC2D
Gene alias: CLAX|LLT1|OCIL
Gene description: C-type lectin domain family 2, member D
Genbank accession: BC019883
Immunogen: CLEC2D (AAH19883, 1 a.a. ~ 154 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MHDSNNVEKDITPSELPANPGCVHSKEHSIKATLIWRLFFLIMFLTIIVCGMVAALSAIRANCHQEPSVCLQAACPESWIGFQRKCFYFSDDTKNWTSSQRFCDSQDADLAQVESFQELNFLLRYKGPSDHWIGLSREQGQPWKWINGTEWTRQ
Protein accession: AAH19883
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00029121-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (42.68 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Vaccinia Virus WR induces rapid surface expression of a host molecule detected by the antibody 4C7 that is distinct from CLEC2D.Williams KJ, Eaton HE, Jones L, Rengan S, Burshtyn DN.
Microbiol Immunol. 2016 Nov;60(11):754-769.

Reviews

Buy CLEC2D monoclonal antibody (M03), clone 2E11 now

Add to cart