Brand: | Abnova |
Reference: | H00029121-M01 |
Product name: | CLEC2D monoclonal antibody (M01), clone 4C7 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant CLEC2D. |
Clone: | 4C7 |
Isotype: | IgG1 Kappa |
Gene id: | 29121 |
Gene name: | CLEC2D |
Gene alias: | CLAX|LLT1|OCIL |
Gene description: | C-type lectin domain family 2, member D |
Genbank accession: | BC019883 |
Immunogen: | CLEC2D (AAH19883, 1 a.a. ~ 154 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MHDSNNVEKDITPSELPANPGCVHSKEHSIKATLIWRLFFLIMFLTIIVCGMVAALSAIRANCHQEPSVCLQAACPESWIGFQRKCFYFSDDTKNWTSSQRFCDSQDADLAQVESFQELNFLLRYKGPSDHWIGLSREQGQPWKWINGTEWTRQ |
Protein accession: | AAH19883 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (42.68 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to CLEC2D on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml] |
Applications: | IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |
Publications: | Expression of Lectin-Like Transcript 1, the Ligand for CD161, in Rheumatoid Arthritis.Chalan P, Bijzet J, Huitema MG, Kroesen BJ, Brouwer E, Boots AM. PLoS One. 2015 Jul 6;10(7):e0132436. |