CLEC2D monoclonal antibody (M01), clone 4C7 View larger

CLEC2D monoclonal antibody (M01), clone 4C7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CLEC2D monoclonal antibody (M01), clone 4C7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,S-ELISA,ELISA,WB-Re,WB-Tr

More info about CLEC2D monoclonal antibody (M01), clone 4C7

Brand: Abnova
Reference: H00029121-M01
Product name: CLEC2D monoclonal antibody (M01), clone 4C7
Product description: Mouse monoclonal antibody raised against a full length recombinant CLEC2D.
Clone: 4C7
Isotype: IgG1 Kappa
Gene id: 29121
Gene name: CLEC2D
Gene alias: CLAX|LLT1|OCIL
Gene description: C-type lectin domain family 2, member D
Genbank accession: BC019883
Immunogen: CLEC2D (AAH19883, 1 a.a. ~ 154 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MHDSNNVEKDITPSELPANPGCVHSKEHSIKATLIWRLFFLIMFLTIIVCGMVAALSAIRANCHQEPSVCLQAACPESWIGFQRKCFYFSDDTKNWTSSQRFCDSQDADLAQVESFQELNFLLRYKGPSDHWIGLSREQGQPWKWINGTEWTRQ
Protein accession: AAH19883
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00029121-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (42.68 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00029121-M01-3-6-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to CLEC2D on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml]
Applications: IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice
Publications: Expression of Lectin-Like Transcript 1, the Ligand for CD161, in Rheumatoid Arthritis.Chalan P, Bijzet J, Huitema MG, Kroesen BJ, Brouwer E, Boots AM.
PLoS One. 2015 Jul 6;10(7):e0132436.

Reviews

Buy CLEC2D monoclonal antibody (M01), clone 4C7 now

Add to cart