Brand: | Abnova |
Reference: | H00029114-M01 |
Product name: | TAGLN3 monoclonal antibody (M01), clone 1D2 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant TAGLN3. |
Clone: | 1D2 |
Isotype: | IgG1 kappa |
Gene id: | 29114 |
Gene name: | TAGLN3 |
Gene alias: | NP22|NP25 |
Gene description: | transgelin 3 |
Genbank accession: | BC015329 |
Immunogen: | TAGLN3 (AAH15329, 1 a.a. ~ 199 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MANRGPSYGLSREVQEKIEQKYDADLENKLVDWIILQCAEDIEHPPPGRAHFQKWLMDGTVLCKLINSLYPPGQEPIPKISESKMAFKQMEQISQFLKAAETYGVRTTDIFQTVDLWEGKDMAAVQRTLMALGSVAVTKDDGCYRGEPSWFHRKAQQNRRGFSEEQLRQGQNVIGLQMGSNKGASQAGMTGYGMPRQIM |
Protein accession: | AAH15329 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (47.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | TAGLN3 monoclonal antibody (M01), clone 1D2 Western Blot analysis of TAGLN3 expression in IMR-32 ( Cat # L008V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |