TAGLN3 monoclonal antibody (M01), clone 1D2 View larger

TAGLN3 monoclonal antibody (M01), clone 1D2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TAGLN3 monoclonal antibody (M01), clone 1D2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about TAGLN3 monoclonal antibody (M01), clone 1D2

Brand: Abnova
Reference: H00029114-M01
Product name: TAGLN3 monoclonal antibody (M01), clone 1D2
Product description: Mouse monoclonal antibody raised against a full length recombinant TAGLN3.
Clone: 1D2
Isotype: IgG1 kappa
Gene id: 29114
Gene name: TAGLN3
Gene alias: NP22|NP25
Gene description: transgelin 3
Genbank accession: BC015329
Immunogen: TAGLN3 (AAH15329, 1 a.a. ~ 199 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MANRGPSYGLSREVQEKIEQKYDADLENKLVDWIILQCAEDIEHPPPGRAHFQKWLMDGTVLCKLINSLYPPGQEPIPKISESKMAFKQMEQISQFLKAAETYGVRTTDIFQTVDLWEGKDMAAVQRTLMALGSVAVTKDDGCYRGEPSWFHRKAQQNRRGFSEEQLRQGQNVIGLQMGSNKGASQAGMTGYGMPRQIM
Protein accession: AAH15329
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00029114-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (47.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00029114-M01-1-19-1.jpg
Application image note: TAGLN3 monoclonal antibody (M01), clone 1D2 Western Blot analysis of TAGLN3 expression in IMR-32 ( Cat # L008V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy TAGLN3 monoclonal antibody (M01), clone 1D2 now

Add to cart