FHOD1 monoclonal antibody (M02), clone 3F7 View larger

FHOD1 monoclonal antibody (M02), clone 3F7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FHOD1 monoclonal antibody (M02), clone 3F7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about FHOD1 monoclonal antibody (M02), clone 3F7

Brand: Abnova
Reference: H00029109-M02
Product name: FHOD1 monoclonal antibody (M02), clone 3F7
Product description: Mouse monoclonal antibody raised against a partial recombinant FHOD1.
Clone: 3F7
Isotype: IgG2a Kappa
Gene id: 29109
Gene name: FHOD1
Gene alias: FHOS
Gene description: formin homology 2 domain containing 1
Genbank accession: NM_013241
Immunogen: FHOD1 (NP_037373.1, 2 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: AGGEDRGDGEPVSVVTVRVQYLEDTDPFACANFPEPRRAPTCSLDGALPLGAQIPAVHRLLGAPLKLEDCALQVSPSGYYLDTELSLEEQREMLEGFY
Protein accession: NP_037373.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00029109-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.52 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy FHOD1 monoclonal antibody (M02), clone 3F7 now

Add to cart