Cart 6 Product Products 616,68 € (empty)
No products
To be determined Shipping
616,68 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 6 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 616,68 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 616,68 €
Data sheet of PYCARD purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,WB-Ti,WB-Tr |
More info about PYCARD purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00029108-B01P |
| Product name: | PYCARD purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human PYCARD protein. |
| Gene id: | 29108 |
| Gene name: | PYCARD |
| Gene alias: | ASC|CARD5|MGC10332|TMS|TMS-1|TMS1 |
| Gene description: | PYD and CARD domain containing |
| Genbank accession: | BC013569 |
| Immunogen: | PYCARD (AAH13569, 1 a.a. ~ 149 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MDALDLTDKLVSFYLETYGAELTANVLRDMGLQEMAGQLQAATHQGSGAAPAGIQAPPQSAAKPGLHFIDQHRAALIARVTNVEWLLDALYGKVLTDEQYQAVRAEPTNPSKMRKLFNFTPAWNWTCKDLLLQALRESQSYLVEDLERS |
| Protein accession: | - |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | PYCARD MaxPab polyclonal antibody. Western Blot analysis of PYCARD expression in MCF-7. |
| Applications: | WB-Ce,WB-Ti,WB-Tr |
| Shipping condition: | Dry Ice |