NXT1 monoclonal antibody (M08), clone 4F11 View larger

NXT1 monoclonal antibody (M08), clone 4F11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NXT1 monoclonal antibody (M08), clone 4F11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab

More info about NXT1 monoclonal antibody (M08), clone 4F11

Brand: Abnova
Reference: H00029107-M08
Product name: NXT1 monoclonal antibody (M08), clone 4F11
Product description: Mouse monoclonal antibody raised against a full length recombinant NXT1.
Clone: 4F11
Isotype: IgG1 Lambda
Gene id: 29107
Gene name: NXT1
Gene alias: MTR2|P15
Gene description: NTF2-like export factor 1
Genbank accession: BC000759
Immunogen: NXT1 (AAH00759, 1 a.a. ~ 140 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MASVDFKTYVDQACRAAEEFVNVYYTTMDKRRRLLSRLYMGTATLVWNGNAVSGQESSSEFFEMLPSSEFQISVVDCQPVHDEATPSQTTVLVVICGSVKFEGNKQRDFNQNFILTAQASPSNTVWKIASDCFRFQDWAS
Protein accession: AAH00759
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00029107-M08-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (41.14 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00029107-M08-42-R01V-1.jpg
Application image note: Western blot analysis of NXT1 over-expressed 293 cell line, cotransfected with NXT1 Validated Chimera RNAi ( Cat # H00029107-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with NXT1 monoclonal antibody (M08), clone 4F11 (Cat # H00029107-M08 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Applications: IF,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab
Shipping condition: Dry Ice

Reviews

Buy NXT1 monoclonal antibody (M08), clone 4F11 now

Add to cart