Brand: | Abnova |
Reference: | H00029107-M08 |
Product name: | NXT1 monoclonal antibody (M08), clone 4F11 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant NXT1. |
Clone: | 4F11 |
Isotype: | IgG1 Lambda |
Gene id: | 29107 |
Gene name: | NXT1 |
Gene alias: | MTR2|P15 |
Gene description: | NTF2-like export factor 1 |
Genbank accession: | BC000759 |
Immunogen: | NXT1 (AAH00759, 1 a.a. ~ 140 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MASVDFKTYVDQACRAAEEFVNVYYTTMDKRRRLLSRLYMGTATLVWNGNAVSGQESSSEFFEMLPSSEFQISVVDCQPVHDEATPSQTTVLVVICGSVKFEGNKQRDFNQNFILTAQASPSNTVWKIASDCFRFQDWAS |
Protein accession: | AAH00759 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (41.14 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Western blot analysis of NXT1 over-expressed 293 cell line, cotransfected with NXT1 Validated Chimera RNAi ( Cat # H00029107-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with NXT1 monoclonal antibody (M08), clone 4F11 (Cat # H00029107-M08 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. |
Applications: | IF,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
Shipping condition: | Dry Ice |