NXT1 MaxPab mouse polyclonal antibody (B01) View larger

NXT1 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NXT1 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,WB-Tr

More info about NXT1 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00029107-B01
Product name: NXT1 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human NXT1 protein.
Gene id: 29107
Gene name: NXT1
Gene alias: MTR2|P15
Gene description: NTF2-like export factor 1
Genbank accession: BC000759
Immunogen: NXT1 (AAH00759, 1 a.a. ~ 140 a.a) full-length human protein.
Immunogen sequence/protein sequence: MASVDFKTYVDQACRAAEEFVNVYYTTMDKRRRLLSRLYMGTATLVWNGNAVSGQESSSEFFEMLPSSEFQISVVDCQPVHDEATPSQTTVLVVICGSVKFEGNKQRDFNQNFILTAQASPSNTVWKIASDCFRFQDWAS
Protein accession: AAH00759
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00029107-B01-13-15-1.jpg
Application image note: Western Blot analysis of NXT1 expression in transfected 293T cell line (H00029107-T01) by NXT1 MaxPab polyclonal antibody.

Lane1:NXT1 transfected lysate(15.51 KDa).
Lane 2:Non-transfected lysate.
Applications: IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy NXT1 MaxPab mouse polyclonal antibody (B01) now

Add to cart