Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of NXT1 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about NXT1 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00029107-A01 |
| Product name: | NXT1 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a full-length recombinant NXT1. |
| Gene id: | 29107 |
| Gene name: | NXT1 |
| Gene alias: | MTR2|P15 |
| Gene description: | NTF2-like export factor 1 |
| Genbank accession: | BC000759 |
| Immunogen: | NXT1 (AAH00759, 1 a.a. ~ 140 a.a) full-length recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | MASVDFKTYVDQACRAAEEFVNVYYTTMDKRRRLLSRLYMGTATLVWNGNAVSGQESSSEFFEMLPSSEFQISVVDCQPVHDEATPSQTTVLVVICGSVKFEGNKQRDFNQNFILTAQASPSNTVWKIASDCFRFQDWAS |
| Protein accession: | AAH00759 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (41.51 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Influenza virus targets the mRNA export machinery and the nuclear pore complex.Satterly N, Tsai PL, van Deursen J, Nussenzveig DR, Wang Y, Faria PA, Levay A, Levy DE, Fontoura BM. Proc Natl Acad Sci U S A. 2007 Feb 6;104(6):1853-8. Epub 2007 Jan 31. |