N6AMT1 MaxPab rabbit polyclonal antibody (D01) View larger

N6AMT1 MaxPab rabbit polyclonal antibody (D01)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of N6AMT1 MaxPab rabbit polyclonal antibody (D01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Tr,IP

More info about N6AMT1 MaxPab rabbit polyclonal antibody (D01)

Brand: Abnova
Reference: H00029104-D01
Product name: N6AMT1 MaxPab rabbit polyclonal antibody (D01)
Product description: Rabbit polyclonal antibody raised against a full-length human N6AMT1 protein.
Gene id: 29104
Gene name: N6AMT1
Gene alias: C21orf127|HEMK2|MGC19995|MTQ2|N6AMT|PRED28
Gene description: N-6 adenine-specific DNA methyltransferase 1 (putative)
Genbank accession: BC011554.1
Immunogen: N6AMT1 (AAH11554.1, 1 a.a. ~ 186 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAGENFATPFHGHVGRGAFSDVYEPAEDTFLLLDALEAAAAELAGVEICLEVGSGSGVVSAFLASMIGPQALYMCTDINPEAAACTLETARCNKVHIQPVITDLVGSHGIEAAWAGGRNGREVMDRFFPLVPDLLSPRGLFYLVTIKENNPEEILKIMKTKGLQGTTALSRQAGQETLSVLKFTKS
Protein accession: AAH11554.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00029104-D01-31-15-1.jpg
Application image note: Immunoprecipitation of N6AMT1 transfected lysate using anti-N6AMT1 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with N6AMT1 MaxPab mouse polyclonal antibody (B01) (H00029104-B01).
Applications: WB-Tr,IP
Shipping condition: Dry Ice

Reviews

Buy N6AMT1 MaxPab rabbit polyclonal antibody (D01) now

Add to cart