Brand: | Abnova |
Reference: | H00029104-A01 |
Product name: | C21orf127 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant C21orf127. |
Gene id: | 29104 |
Gene name: | N6AMT1 |
Gene alias: | C21orf127|HEMK2|MGC19995|MTQ2|N6AMT|PRED28 |
Gene description: | N-6 adenine-specific DNA methyltransferase 1 (putative) |
Genbank accession: | NM_182749 |
Immunogen: | C21orf127 (NP_877426, 87 a.a. ~ 186 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | LETARCNKVHIQPVITDLVGSHGIEAAWAGGRNGREVMDRFFPLVPDLLSPRGLFYLVTIKENNPEEILKIMKTKGLQGTTALSRQAGQETLSVLKFTKS |
Protein accession: | NP_877426 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |