RANGRF monoclonal antibody (M02), clone 1H4 View larger

RANGRF monoclonal antibody (M02), clone 1H4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RANGRF monoclonal antibody (M02), clone 1H4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re,WB-Tr

More info about RANGRF monoclonal antibody (M02), clone 1H4

Brand: Abnova
Reference: H00029098-M02
Product name: RANGRF monoclonal antibody (M02), clone 1H4
Product description: Mouse monoclonal antibody raised against a full-length recombinant RANGRF.
Clone: 1H4
Isotype: IgG2a Kappa
Gene id: 29098
Gene name: RANGRF
Gene alias: DKFZp686F02139|HSPC165|HSPC236|MGC110973|MOG1|RANGNRF
Gene description: RAN guanine nucleotide release factor
Genbank accession: BC100017.1
Immunogen: RANGRF (AAI00018.1, 1 a.a. ~ 146 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MEPTRDCPLFGGAFSAILPMGAIDVSDLRPVPDNQEVFCHPVTDQSLIVELLELQAHVRGEAAARYHFEDVGGVQGARAVHVESVQPLSLENLALRGRCQEAWVLSGKQQIAKENQQVAKDVTLHQALLRLPQYQTDLLLTFNQPP
Protein accession: AAI00018.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00029098-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (42.5 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00029098-M02-13-15-1.jpg
Application image note: Western Blot analysis of RANGRF expression in transfected 293T cell line by RANGRF monoclonal antibody (M02), clone 1H4.

Lane 1: RANGRF transfected lysate (Predicted MW: 16.1 KDa).
Lane 2: Non-transfected lysate.
Applications: IF,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy RANGRF monoclonal antibody (M02), clone 1H4 now

Add to cart