HSPC163 monoclonal antibody (M01), clone 4E10-1G4 View larger

HSPC163 monoclonal antibody (M01), clone 4E10-1G4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HSPC163 monoclonal antibody (M01), clone 4E10-1G4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA

More info about HSPC163 monoclonal antibody (M01), clone 4E10-1G4

Brand: Abnova
Reference: H00029097-M01
Product name: HSPC163 monoclonal antibody (M01), clone 4E10-1G4
Product description: Mouse monoclonal antibody raised against a full length recombinant HSPC163.
Clone: 4E10-1G4
Isotype: IgG2a kappa
Gene id: 29097
Gene name: CNIH4
Gene alias: HSPC163
Gene description: cornichon homolog 4 (Drosophila)
Genbank accession: BC000573
Immunogen: HSPC163 (AAH00573, 1 a.a. ~ 139 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MEAVVFVFSLLDCCALIFLSVYFIITLSDLECDYINARSCCSKLNKWVIPELIGHTIVTVLLLMSLHWFIFLLNLPVATWNIYRYIMVPSGNMGVFDPTEIHNRGQLKSHMKEAMIKLGFHLLCFFMYLYSMILALIND
Protein accession: AAH00573
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00029097-M01-1-4-1.jpg
Application image note: HSPC163 monoclonal antibody (M01), clone 4E10-1G4 Western Blot analysis of HSPC163 expression in A-431 ( Cat # L015V1 ).
Applications: WB-Ce,ELISA
Shipping condition: Dry Ice

Reviews

Buy HSPC163 monoclonal antibody (M01), clone 4E10-1G4 now

Add to cart