Brand: | Abnova |
Reference: | H00029097-M01 |
Product name: | HSPC163 monoclonal antibody (M01), clone 4E10-1G4 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant HSPC163. |
Clone: | 4E10-1G4 |
Isotype: | IgG2a kappa |
Gene id: | 29097 |
Gene name: | CNIH4 |
Gene alias: | HSPC163 |
Gene description: | cornichon homolog 4 (Drosophila) |
Genbank accession: | BC000573 |
Immunogen: | HSPC163 (AAH00573, 1 a.a. ~ 139 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MEAVVFVFSLLDCCALIFLSVYFIITLSDLECDYINARSCCSKLNKWVIPELIGHTIVTVLLLMSLHWFIFLLNLPVATWNIYRYIMVPSGNMGVFDPTEIHNRGQLKSHMKEAMIKLGFHLLCFFMYLYSMILALIND |
Protein accession: | AAH00573 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | HSPC163 monoclonal antibody (M01), clone 4E10-1G4 Western Blot analysis of HSPC163 expression in A-431 ( Cat # L015V1 ). |
Applications: | WB-Ce,ELISA |
Shipping condition: | Dry Ice |