Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re,WB-Tr,IP |
Brand: | Abnova |
Reference: | H00029089-M03 |
Product name: | UBE2T monoclonal antibody (M03), clone 2A12-4F11 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant UBE2T. |
Clone: | 2A12-4F11 |
Isotype: | IgG1 Kappa |
Gene id: | 29089 |
Gene name: | UBE2T |
Gene alias: | HSPC150|PIG50 |
Gene description: | ubiquitin-conjugating enzyme E2T (putative) |
Genbank accession: | BC004152 |
Immunogen: | UBE2T (AAH04152, 1 a.a. ~ 197 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MQRASRLKRELHMLATEPPPGITCWQDKDQMDDLRAQILGGANTPYEKGVFKLEVIIPERYPFEPPQIRFLTPIYHPNIDSAGRICLDVLKLPPKGAWRPSLNIATVLTSIQLLMSEPNPDDPLMADISSEFKYNKPAFLKNARQWTEKHARQKQKADEEEMLDNLPEAGDSRVHNSTQKRKASQLVGIEKKFHPDV |
Protein accession: | AAH04152 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (47.41 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of UBE2T expression in transfected 293T cell line by UBE2T monoclonal antibody (M03), clone 2A12-4F11. Lane 1: UBE2T transfected lysate(22.5 KDa). Lane 2: Non-transfected lysate. |
Applications: | ELISA,WB-Re,WB-Tr,IP |
Shipping condition: | Dry Ice |