UBE2T monoclonal antibody (M02), clone 4G1-4C2 View larger

UBE2T monoclonal antibody (M02), clone 4G1-4C2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of UBE2T monoclonal antibody (M02), clone 4G1-4C2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re,WB-Tr,IP

More info about UBE2T monoclonal antibody (M02), clone 4G1-4C2

Brand: Abnova
Reference: H00029089-M02
Product name: UBE2T monoclonal antibody (M02), clone 4G1-4C2
Product description: Mouse monoclonal antibody raised against a full-length recombinant UBE2T.
Clone: 4G1-4C2
Isotype: IgG2b Kappa
Gene id: 29089
Gene name: UBE2T
Gene alias: HSPC150|PIG50
Gene description: ubiquitin-conjugating enzyme E2T (putative)
Genbank accession: BC004152
Immunogen: UBE2T (AAH04152, 1 a.a. ~ 197 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MQRASRLKRELHMLATEPPPGITCWQDKDQMDDLRAQILGGANTPYEKGVFKLEVIIPERYPFEPPQIRFLTPIYHPNIDSAGRICLDVLKLPPKGAWRPSLNIATVLTSIQLLMSEPNPDDPLMADISSEFKYNKPAFLKNARQWTEKHARQKQKADEEEMLDNLPEAGDSRVHNSTQKRKASQLVGIEKKFHPDV
Protein accession: AAH04152
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00029089-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (47.41 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00029089-M02-13-15-1.jpg
Application image note: Western Blot analysis of UBE2T expression in transfected 293T cell line by UBE2T monoclonal antibody (M02), clone 4G1-4C2.

Lane 1: UBE2T transfected lysate(22.5 KDa).
Lane 2: Non-transfected lysate.
Applications: ELISA,WB-Re,WB-Tr,IP
Shipping condition: Dry Ice

Reviews

Buy UBE2T monoclonal antibody (M02), clone 4G1-4C2 now

Add to cart