UBE2T monoclonal antibody (M01), clone 1E12-4A3 View larger

UBE2T monoclonal antibody (M01), clone 1E12-4A3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of UBE2T monoclonal antibody (M01), clone 1E12-4A3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re,IP

More info about UBE2T monoclonal antibody (M01), clone 1E12-4A3

Brand: Abnova
Reference: H00029089-M01
Product name: UBE2T monoclonal antibody (M01), clone 1E12-4A3
Product description: Mouse monoclonal antibody raised against a full length recombinant UBE2T.
Clone: 1E12-4A3
Isotype: IgG2b kappa
Gene id: 29089
Gene name: UBE2T
Gene alias: HSPC150|PIG50
Gene description: ubiquitin-conjugating enzyme E2T (putative)
Genbank accession: BC004152
Immunogen: UBE2T (AAH04152, 1 a.a. ~ 197 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MQRASRLKRELHMLATEPPPGITCWQDKDQMDDLRAQILGGANTPYEKGVFKLEVIIPERYPFEPPQIRFLTPIYHPNIDSAGRICLDVLKLPPKGAWRPSLNIATVLTSIQLLMSEPNPDDPLMADISSEFKYNKPAFLKNARQWTEKHARQKQKADEEEMLDNLPEAGDSRVHNSTQKRKASQLVGIEKKFHPDV
Protein accession: AAH04152
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00029089-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (47.41 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00029089-M01-1-1-1.jpg
Application image note: UBE2T monoclonal antibody (M01), clone 1E12-4A3 Western Blot analysis of UBE2T expression in Hela ( Cat # L013V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re,IP
Shipping condition: Dry Ice
Publications: Hypoxia disrupts the Fanconi anemia pathway and sensitizes cells to chemotherapy through regulation of UBE2T.Ramaekers CH, van den Beucken T, Meng A, Kassam S, Thoms J, Bristow RG, Wouters BG.
Radiother Oncol. 2011 Jun 29. [Epub ahead of print]

Reviews

Buy UBE2T monoclonal antibody (M01), clone 1E12-4A3 now

Add to cart