MED4 monoclonal antibody (M01), clone 2B10 View larger

MED4 monoclonal antibody (M01), clone 2B10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MED4 monoclonal antibody (M01), clone 2B10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re,WB-Tr

More info about MED4 monoclonal antibody (M01), clone 2B10

Brand: Abnova
Reference: H00029079-M01
Product name: MED4 monoclonal antibody (M01), clone 2B10
Product description: Mouse monoclonal antibody raised against a full-length recombinant MED4.
Clone: 2B10
Isotype: IgG2a Kappa
Gene id: 29079
Gene name: MED4
Gene alias: DRIP36|FLJ10956|HSPC126|RP11-90M2.2|TRAP36|VDRIP
Gene description: mediator complex subunit 4
Genbank accession: BC005189
Immunogen: MED4 (AAH05189, 1 a.a. ~ 270 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MAASSSGEKEKERLGGGLGVAGGNSTRERLLSALEDLEVLSRELIEMLAISRNQKLLQAGEENQVLELLIHRDGEFQELMKLALNQGKIHHEMQVLEKEVEKRDGDIQQLQKQLKEAEQILATAVYQAKEKLKSIEKARKGAISSEEIIKYAHRISASNAVCAPLTWVPGDPRRPYPTDLEMRSGLLGQMNNPSTNGVNGHLPGDALAAGRLPDVLAPQYPWQSNDMSMNMLPPNHSSDFLLEPPGHNKEDEDDVEIMSTDSSSSSSESD
Protein accession: AAH05189
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00029079-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (55.44 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00029079-M01-13-15-1.jpg
Application image note: Western Blot analysis of MED4 expression in transfected 293T cell line by MED4 monoclonal antibody (M01), clone 2B10.

Lane 1: MED4 transfected lysate(29.7 KDa).
Lane 2: Non-transfected lysate.
Applications: IF,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy MED4 monoclonal antibody (M01), clone 2B10 now

Add to cart