C20orf30 polyclonal antibody (A01) View larger

C20orf30 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of C20orf30 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about C20orf30 polyclonal antibody (A01)

Brand: Abnova
Reference: H00029058-A01
Product name: C20orf30 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a full-length recombinant C20orf30.
Gene id: 29058
Gene name: C20orf30
Gene alias: HSPC274|dJ1116H23.2.1
Gene description: chromosome 20 open reading frame 30
Genbank accession: BC009768
Immunogen: C20orf30 (AAH09768, 1 a.a. ~ 120 a.a) full-length recombinant protein with GST tag.
Immunogen sequence/protein sequence: MMPSRTNLATGIPSSKVKYSRLSSTDDGYIDLQFKKTPPKIPYKAIALATVLFLIGAFLIIIGSLLLSGYISKGGADRAVPVLIIGILVFLPGFYHLRIAYYASKGYRGYSYDDIPDFDD
Protein accession: AAH09768
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00029058-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (39.31 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy C20orf30 polyclonal antibody (A01) now

Add to cart