Brand: | Abnova |
Reference: | H00028999-M02 |
Product name: | KLF15 monoclonal antibody (M02), clone 1F3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant KLF15. |
Clone: | 1F3 |
Isotype: | IgG2b Kappa |
Gene id: | 28999 |
Gene name: | KLF15 |
Gene alias: | DKFZp779M1320|KKLF |
Gene description: | Kruppel-like factor 15 |
Genbank accession: | NM_014079 |
Immunogen: | KLF15 (NP_054798.1, 1 a.a. ~ 78 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MVDHLLPVDENFSSPKCPVGYLGDRLVGRRAYHMLPSPVSEDDSDASSPCSCSSPDSQALCSCYGGGLGTESQDSILD |
Protein accession: | NP_054798.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (34.32 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged KLF15 is 1 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr,IP |
Shipping condition: | Dry Ice |