KLF15 monoclonal antibody (M02), clone 1F3 View larger

KLF15 monoclonal antibody (M02), clone 1F3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of KLF15 monoclonal antibody (M02), clone 1F3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr,IP

More info about KLF15 monoclonal antibody (M02), clone 1F3

Brand: Abnova
Reference: H00028999-M02
Product name: KLF15 monoclonal antibody (M02), clone 1F3
Product description: Mouse monoclonal antibody raised against a partial recombinant KLF15.
Clone: 1F3
Isotype: IgG2b Kappa
Gene id: 28999
Gene name: KLF15
Gene alias: DKFZp779M1320|KKLF
Gene description: Kruppel-like factor 15
Genbank accession: NM_014079
Immunogen: KLF15 (NP_054798.1, 1 a.a. ~ 78 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MVDHLLPVDENFSSPKCPVGYLGDRLVGRRAYHMLPSPVSEDDSDASSPCSCSSPDSQALCSCYGGGLGTESQDSILD
Protein accession: NP_054798.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00028999-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (34.32 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00028999-M02-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged KLF15 is 1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr,IP
Shipping condition: Dry Ice

Reviews

Buy KLF15 monoclonal antibody (M02), clone 1F3 now

Add to cart