Cart 95 Product Products 37 380,14 € (empty)
No products
To be determined Shipping
37 380,14 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 95 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 37 380,14 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 37 380,14 €
Data sheet of MRPL13 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Ti |
More info about MRPL13 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand: | Abnova |
| Reference: | H00028998-D01P |
| Product name: | MRPL13 purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human MRPL13 protein. |
| Gene id: | 28998 |
| Gene name: | MRPL13 |
| Gene alias: | L13|L13A|L13mt|RPL13|RPML13 |
| Gene description: | mitochondrial ribosomal protein L13 |
| Genbank accession: | NM_014078.4 |
| Immunogen: | MRPL13 (NP_054797.2, 1 a.a. ~ 178 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MSSFSRAPQQWATFARIWYLLDGKMQPPGKLAAMASIRLQGLHKPVYHALSDCGDHVVIMNTRHIAFSGNKWEQKVYSSHTGYPGGFRQVTAAQLHLRDPVAIVKLAIYGMLPKNLHRRTMMERLHLFPDEYIPEDILKNLVEELPQPRKIPKRLDEYTQEEIDAFPRLWTPPEDYRL |
| Protein accession: | NP_054797.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | MRPL13 MaxPab rabbit polyclonal antibody. Western Blot analysis of MRPL13 expression in human kidney. |
| Applications: | WB-Ti |
| Shipping condition: | Dry Ice |