HIPK2 monoclonal antibody (M08), clone 1D8 View larger

HIPK2 monoclonal antibody (M08), clone 1D8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HIPK2 monoclonal antibody (M08), clone 1D8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about HIPK2 monoclonal antibody (M08), clone 1D8

Brand: Abnova
Reference: H00028996-M08
Product name: HIPK2 monoclonal antibody (M08), clone 1D8
Product description: Mouse monoclonal antibody raised against a full length recombinant HIPK2.
Clone: 1D8
Isotype: IgG2b Kappa
Gene id: 28996
Gene name: HIPK2
Gene alias: DKFZp686K02111|FLJ23711|PRO0593
Gene description: homeodomain interacting protein kinase 2
Genbank accession: NM_022740.2
Immunogen: HIPK2 (NP_073577.2, 213 a.a. ~ 293 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: PSSTSATISLANPEVSILNYPSTLYQPSAASMAAVAQRSMPLQTGTAQICARPDPFQQAL IVCPPGFQGLQASPSKHAGYS
Protein accession: NP_073577.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00028996-M08-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (34.91 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy HIPK2 monoclonal antibody (M08), clone 1D8 now

Add to cart