Brand: | Abnova |
Reference: | H00028996-M08 |
Product name: | HIPK2 monoclonal antibody (M08), clone 1D8 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant HIPK2. |
Clone: | 1D8 |
Isotype: | IgG2b Kappa |
Gene id: | 28996 |
Gene name: | HIPK2 |
Gene alias: | DKFZp686K02111|FLJ23711|PRO0593 |
Gene description: | homeodomain interacting protein kinase 2 |
Genbank accession: | NM_022740.2 |
Immunogen: | HIPK2 (NP_073577.2, 213 a.a. ~ 293 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | PSSTSATISLANPEVSILNYPSTLYQPSAASMAAVAQRSMPLQTGTAQICARPDPFQQAL IVCPPGFQGLQASPSKHAGYS |
Protein accession: | NP_073577.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (34.91 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |