HIPK2 monoclonal antibody (M03), clone 1F10 View larger

HIPK2 monoclonal antibody (M03), clone 1F10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HIPK2 monoclonal antibody (M03), clone 1F10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Rat
Host speciesMouse
ApplicationsWB-Ce,IHC-P,S-ELISA,ELISA

More info about HIPK2 monoclonal antibody (M03), clone 1F10

Brand: Abnova
Reference: H00028996-M03
Product name: HIPK2 monoclonal antibody (M03), clone 1F10
Product description: Mouse monoclonal antibody raised against a partial recombinant HIPK2.
Clone: 1F10
Isotype: IgG2a Kappa
Gene id: 28996
Gene name: HIPK2
Gene alias: DKFZp686K02111|FLJ23711|PRO0593
Gene description: homeodomain interacting protein kinase 2
Genbank accession: AF208291
Immunogen: HIPK2 (AAG41236.1, 961 a.a. ~ 1065 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: TGNPRTIIVPPLKTQASEVLVECDSLVPVNTSHHSSSYKSKSSSNVTSTSGHSSGSSSGAITYRQQRPGPHFQQQQPLNLSQAQQHITTDRTGSHRRQQAYITPT
Protein accession: AAG41236.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Rat
Application image: H00028996-M03-3-35-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to HIPK2 on formalin-fixed paraffin-embedded human esophagus. [antibody concentration 1 ug/ml]
Applications: WB-Ce,IHC-P,S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy HIPK2 monoclonal antibody (M03), clone 1F10 now

Add to cart