HIPK2 monoclonal antibody (M01), clone 4F4 View larger

HIPK2 monoclonal antibody (M01), clone 4F4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HIPK2 monoclonal antibody (M01), clone 4F4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Rat
Host speciesMouse
ApplicationsWB-Ce,WB-Ti,S-ELISA,ELISA,WB-Re

More info about HIPK2 monoclonal antibody (M01), clone 4F4

Brand: Abnova
Reference: H00028996-M01
Product name: HIPK2 monoclonal antibody (M01), clone 4F4
Product description: Mouse monoclonal antibody raised against a partial recombinant HIPK2.
Clone: 4F4
Isotype: IgG2b Kappa
Gene id: 28996
Gene name: HIPK2
Gene alias: DKFZp686K02111|FLJ23711|PRO0593
Gene description: homeodomain interacting protein kinase 2
Genbank accession: AF208291
Immunogen: HIPK2 (AAG41236.1, 961 a.a. ~ 1065 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: TGNPRTIIVPPLKTQASEVLVECDSLVPVNTSHHSSSYKSKSSSNVTSTSGHSSGSSSGAITYRQQRPGPHFQQQQPLNLSQAQQHITTDRTGSHRRQQAYITPT
Protein accession: AAG41236.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00028996-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.29 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Rat
Application image: H00028996-M01-2-A5-1.jpg
Application image note: HIPK2 monoclonal antibody (M01), clone 4F4. Western Blot analysis of HIPK2 expression in human ovarian cancer.
Applications: WB-Ce,WB-Ti,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: High-Mobility Group A1 Proteins Regulate p53-Mediated Transcription of Bcl-2 Gene.Esposito F, Tornincasa M, Chieffi P, De Martino I, Pierantoni GM, Fusco A.
Cancer Res. 2010 Jul 1;70(13):5379-88. Epub 2010 Jun 8.

Reviews

Buy HIPK2 monoclonal antibody (M01), clone 4F4 now

Add to cart