Brand: | Abnova |
Reference: | H00028996-M01 |
Product name: | HIPK2 monoclonal antibody (M01), clone 4F4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant HIPK2. |
Clone: | 4F4 |
Isotype: | IgG2b Kappa |
Gene id: | 28996 |
Gene name: | HIPK2 |
Gene alias: | DKFZp686K02111|FLJ23711|PRO0593 |
Gene description: | homeodomain interacting protein kinase 2 |
Genbank accession: | AF208291 |
Immunogen: | HIPK2 (AAG41236.1, 961 a.a. ~ 1065 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | TGNPRTIIVPPLKTQASEVLVECDSLVPVNTSHHSSSYKSKSSSNVTSTSGHSSGSSSGAITYRQQRPGPHFQQQQPLNLSQAQQHITTDRTGSHRRQQAYITPT |
Protein accession: | AAG41236.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.29 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Rat |
Application image: |  |
Application image note: | HIPK2 monoclonal antibody (M01), clone 4F4. Western Blot analysis of HIPK2 expression in human ovarian cancer. |
Applications: | WB-Ce,WB-Ti,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | High-Mobility Group A1 Proteins Regulate p53-Mediated Transcription of Bcl-2 Gene.Esposito F, Tornincasa M, Chieffi P, De Martino I, Pierantoni GM, Fusco A. Cancer Res. 2010 Jul 1;70(13):5379-88. Epub 2010 Jun 8. |