MCTS1 monoclonal antibody (M01A), clone 1G1-2A2 View larger

MCTS1 monoclonal antibody (M01A), clone 1G1-2A2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MCTS1 monoclonal antibody (M01A), clone 1G1-2A2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about MCTS1 monoclonal antibody (M01A), clone 1G1-2A2

Brand: Abnova
Reference: H00028985-M01A
Product name: MCTS1 monoclonal antibody (M01A), clone 1G1-2A2
Product description: Mouse monoclonal antibody raised against a full-length recombinant MCTS1.
Clone: 1G1-2A2
Isotype: IgM Kappa
Gene id: 28985
Gene name: MCTS1
Gene alias: FLJ39637|MCT-1|MCT1
Gene description: malignant T cell amplified sequence 1
Genbank accession: BC001013
Immunogen: MCTS1 (AAH01013, 1 a.a. ~ 181 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHIEILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTYK
Protein accession: AAH01013
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00028985-M01A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (45.65 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy MCTS1 monoclonal antibody (M01A), clone 1G1-2A2 now

Add to cart