RGC32 (Human) Recombinant Protein (Q02) View larger

RGC32 (Human) Recombinant Protein (Q02)

New product

374,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RGC32 (Human) Recombinant Protein (Q02)

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about RGC32 (Human) Recombinant Protein (Q02)

Brand: Abnova
Reference: H00028984-Q02
Product name: RGC32 (Human) Recombinant Protein (Q02)
Product description: Human RGC32 partial ORF ( NP_054778.1, 1 a.a. - 117 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 28984
Gene name: C13orf15
Gene alias: KIAA0564|MGC87338|RGC-32|RGC32|bA157L14.2
Gene description: chromosome 13 open reading frame 15
Genbank accession: NM_014059
Immunogen sequence/protein sequence: MKPPAEDLSDALCEFDAVLADFASPFHERHFHYEEHLERMKRRSSASVSDSSGFSDSESADSLYRNSFSFSDEKLNSPTDSTPALLSATVTPQKAKLGDTKELEAFIADLDKTLASM
Protein accession: NP_054778.1
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture: qc_test-H00028984-Q02-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy RGC32 (Human) Recombinant Protein (Q02) now

Add to cart