C13orf15 monoclonal antibody (M01), clone 3B9 View larger

C13orf15 monoclonal antibody (M01), clone 3B9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of C13orf15 monoclonal antibody (M01), clone 3B9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA

More info about C13orf15 monoclonal antibody (M01), clone 3B9

Brand: Abnova
Reference: H00028984-M01
Product name: C13orf15 monoclonal antibody (M01), clone 3B9
Product description: Mouse monoclonal antibody raised against a partial recombinant C13orf15.
Clone: 3B9
Isotype: IgG1 Kappa
Gene id: 28984
Gene name: C13orf15
Gene alias: KIAA0564|MGC87338|RGC-32|RGC32|bA157L14.2
Gene description: chromosome 13 open reading frame 15
Genbank accession: NM_014059
Immunogen: C13orf15 (NP_054778.1, 1 a.a. ~ 117 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MKPPAEDLSDALCEFDAVLADFASPFHERHFHYEEHLERMKRRSSASVSDSSGFSDSESADSLYRNSFSFSDEKLNSPTDSTPALLSATVTPQKAKLGDTKELEAFIADLDKTLASM
Protein accession: NP_054778.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00028984-M01-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged C13orf15 is 0.03 ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy C13orf15 monoclonal antibody (M01), clone 3B9 now

Add to cart