FLVCR monoclonal antibody (M05), clone 4B2 View larger

FLVCR monoclonal antibody (M05), clone 4B2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FLVCR monoclonal antibody (M05), clone 4B2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab

More info about FLVCR monoclonal antibody (M05), clone 4B2

Brand: Abnova
Reference: H00028982-M05
Product name: FLVCR monoclonal antibody (M05), clone 4B2
Product description: Mouse monoclonal antibody raised against a partial recombinant FLVCR.
Clone: 4B2
Isotype: IgG2b Kappa
Gene id: 28982
Gene name: FLVCR1
Gene alias: FLVCR
Gene description: feline leukemia virus subgroup C cellular receptor 1
Genbank accession: NM_014053
Immunogen: FLVCR (NP_054772, 1 a.a. ~ 83 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MARPDDEEGAAVAPGHPLAKGYLPLPRGAPVGKESVELQNGPKAGTFPVNGAPRDSLAAASGVLGGPQTPLAPEEETQARLLP
Protein accession: NP_054772
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00028982-M05-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (34.87 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00028982-M05-42-R01V-1.jpg
Application image note: Western blot analysis of FLVCR over-expressed 293 cell line, cotransfected with FLVCR Validated Chimera RNAi ( Cat # H00028982-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with FLVCR monoclonal antibody (M05), clone 4B2 (Cat # H00028982-M05 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab
Shipping condition: Dry Ice
Publications: Heme-Oxygenases during Erythropoiesis in K562 and Human Bone Marrow Cells.Alves LR, Costa ES, Sorgine MH, Nascimento-Silva MC, Teodosio C, Barcena P, Castro-Faria-Neto HC, Bozza PT, Orfao A, Oliveira PL, Maya-Monteiro CM.
PLoS One. 2011;6(7):e21358. Epub 2011 Jul 13.

Reviews

Buy FLVCR monoclonal antibody (M05), clone 4B2 now

Add to cart