Cart 6 Product Products 616,68 € (empty)
No products
To be determined Shipping
616,68 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 6 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 616,68 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 616,68 €
Data sheet of MRPL42 purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Tr |
More info about MRPL42 purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00028977-B01P |
| Product name: | MRPL42 purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human MRPL42 protein. |
| Gene id: | 28977 |
| Gene name: | MRPL42 |
| Gene alias: | HSPC204|MRP-L31|MRPL31|MRPS32|PTD007|RPML31 |
| Gene description: | mitochondrial ribosomal protein L42 |
| Genbank accession: | NM_014050.2 |
| Immunogen: | MRPL42 (NP_054769.1, 1 a.a. ~ 142 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MAVAAVKWVMSKRTILKHLFPVQNGALYCVCHKSTYSPLPDDYNCNVELALTSDGRTIVCYHPSVDIPYEHTKPIPRPDPVHNNEETHDQVLKTRLEEKVEHLEEGPMIEQLSKMFFTTKHRWYPHGRYHRCRKNLNPPKDR |
| Protein accession: | NP_054769.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of MRPL42 expression in transfected 293T cell line (H00028977-T01) by MRPL42 MaxPab polyclonal antibody. Lane 1: MRPL42 transfected lysate(15.62 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |