MRPS18B purified MaxPab mouse polyclonal antibody (B02P) View larger

MRPS18B purified MaxPab mouse polyclonal antibody (B02P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MRPS18B purified MaxPab mouse polyclonal antibody (B02P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about MRPS18B purified MaxPab mouse polyclonal antibody (B02P)

Brand: Abnova
Reference: H00028973-B02P
Product name: MRPS18B purified MaxPab mouse polyclonal antibody (B02P)
Product description: Mouse polyclonal antibody raised against a full-length human MRPS18B protein.
Gene id: 28973
Gene name: MRPS18B
Gene alias: C6orf14|DKFZp564H0223|HSPC183|HumanS18a|MRP-S18-2|MRPS18-2|PTD017|S18amt
Gene description: mitochondrial ribosomal protein S18B
Genbank accession: NM_014046.2
Immunogen: MRPS18B (NP_054765.1, 1 a.a. ~ 258 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAASVLNTVLRRLPMLSLFRGSHRVQVPLQTLCTKAPSEEDSLSSVPISPYKDEPWKYLESEEYQERYGSRPVWADYRRNHKGGVPPQRTRKTCIRRNKVVGNPCPICRDHKLHVDFRNVKLLEQFVCAHTGIIFYAPYTGVCVKQHKRLTQAIQKARDHGLLIYHIPQVEPRDLDFSTSHGAVSATPPAPTLVSGDPWYPWYNWKQPPERELSRLRRLYQGHLQEESGPPPESMPKMPPRTPAEASSTGQTGPQSAL
Protein accession: NP_054765.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00028973-B02P-13-15-1.jpg
Application image note: Western Blot analysis of MRPS18B expression in transfected 293T cell line (H00028973-T02) by MRPS18B MaxPab polyclonal antibody.

Lane 1: MRPS18B transfected lysate(28.38 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy MRPS18B purified MaxPab mouse polyclonal antibody (B02P) now

Add to cart