BZW2 purified MaxPab mouse polyclonal antibody (B01P) View larger

BZW2 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of BZW2 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about BZW2 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00028969-B01P
Product name: BZW2 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human BZW2 protein.
Gene id: 28969
Gene name: BZW2
Gene alias: HSPC028|MST017|MSTP017
Gene description: basic leucine zipper and W2 domains 2
Genbank accession: NM_014038
Immunogen: BZW2 (NP_054757.1, 1 a.a. ~ 419 a.a) full-length human protein.
Immunogen sequence/protein sequence: MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLDYRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLIRRYKYLEKAFEDEMKKLLLFLKAFSETEQTKLAMLSGILLGNGTLPATILTSLFTDSLVKEGIAASFAVKLFKAWMAEKDANSVTSSLRKANLDKRLLELFPVNRQSVDHFAKYFTDAGLKELSDFLRVQQSLGTRKELQKELQERLSQECPIKEVVLYVKEEMKRNDLPETAVIGLLWTCIMNAVEWNKKEELVAEQALKHLKQYAPLLAVFSSQGQSELILLQKVQEYCYDNIHFMKAFQKIVVLFYKADVLSEEAILKWYKEAHVAKGKSVFLDQMKKFVEWLQNAEEESESEGEEN
Protein accession: NP_054757.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00028969-B01P-13-15-1.jpg
Application image note: Western Blot analysis of BZW2 expression in transfected 293T cell line (H00028969-T02) by BZW2 MaxPab polyclonal antibody.

Lane 1: BZW2 transfected lysate(46.09 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy BZW2 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart