Brand: | Abnova |
Reference: | H00028966-M01 |
Product name: | SNX24 monoclonal antibody (M01), clone 2A11 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant SNX24. |
Clone: | 2A11 |
Isotype: | IgG2a Kappa |
Gene id: | 28966 |
Gene name: | SNX24 |
Gene alias: | PRO1284|SBBI31 |
Gene description: | sorting nexin 24 |
Genbank accession: | BC010886 |
Immunogen: | SNX24 (AAH10886, 1 a.a. ~ 169 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MEVYIPSFRYEESDLERGYTVFKIEVLMNGRKHFVEKRYSEFHALHKKLKKCIKTPEIPSKHVRNWVPKVLEQRRQGLETYLQAVILENEELPKLFLDFLNVRHLPSLPKAESCGSFDETESEESSKLSHQPVLLFLGDPYVLPAASDFPNVVIEGVLHGIFYPHLQPR |
Protein accession: | AAH10886 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged SNX24 is 3 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |