SNX24 monoclonal antibody (M01), clone 2A11 View larger

SNX24 monoclonal antibody (M01), clone 2A11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SNX24 monoclonal antibody (M01), clone 2A11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about SNX24 monoclonal antibody (M01), clone 2A11

Brand: Abnova
Reference: H00028966-M01
Product name: SNX24 monoclonal antibody (M01), clone 2A11
Product description: Mouse monoclonal antibody raised against a full-length recombinant SNX24.
Clone: 2A11
Isotype: IgG2a Kappa
Gene id: 28966
Gene name: SNX24
Gene alias: PRO1284|SBBI31
Gene description: sorting nexin 24
Genbank accession: BC010886
Immunogen: SNX24 (AAH10886, 1 a.a. ~ 169 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MEVYIPSFRYEESDLERGYTVFKIEVLMNGRKHFVEKRYSEFHALHKKLKKCIKTPEIPSKHVRNWVPKVLEQRRQGLETYLQAVILENEELPKLFLDFLNVRHLPSLPKAESCGSFDETESEESSKLSHQPVLLFLGDPYVLPAASDFPNVVIEGVLHGIFYPHLQPR
Protein accession: AAH10886
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00028966-M01-9-18-1.jpg
Application image note: Detection limit for recombinant GST tagged SNX24 is 3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy SNX24 monoclonal antibody (M01), clone 2A11 now

Add to cart