REM1 monoclonal antibody (M02), clone 3A9 View larger

REM1 monoclonal antibody (M02), clone 3A9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of REM1 monoclonal antibody (M02), clone 3A9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA

More info about REM1 monoclonal antibody (M02), clone 3A9

Brand: Abnova
Reference: H00028954-M02
Product name: REM1 monoclonal antibody (M02), clone 3A9
Product description: Mouse monoclonal antibody raised against a partial recombinant REM1.
Clone: 3A9
Isotype: IgG2a Kappa
Gene id: 28954
Gene name: REM1
Gene alias: GD:REM|GES|MGC48669|REM
Gene description: RAS (RAD and GEM)-like GTP-binding 1
Genbank accession: NM_014012
Immunogen: REM1 (NP_054731, 162 a.a. ~ 251 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SIADRGSFESASELRIQLRRTHQADHVPIILVGNKADLARCREVSVEEGRACAVVFDCKFIETSATLQHNVAELFEGVVRQLRLRRRDSA
Protein accession: NP_054731
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA
Shipping condition: Dry Ice

Reviews

Buy REM1 monoclonal antibody (M02), clone 3A9 now

Add to cart