TRIB2 monoclonal antibody (M11), clone 1D11 View larger

TRIB2 monoclonal antibody (M11), clone 1D11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TRIB2 monoclonal antibody (M11), clone 1D11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,IP

More info about TRIB2 monoclonal antibody (M11), clone 1D11

Brand: Abnova
Reference: H00028951-M11
Product name: TRIB2 monoclonal antibody (M11), clone 1D11
Product description: Mouse monoclonal antibody raised against a full-length recombinant TRIB2.
Clone: 1D11
Isotype: IgG2a Kappa
Gene id: 28951
Gene name: TRIB2
Gene alias: C5FW|GS3955|TRB2
Gene description: tribbles homolog 2 (Drosophila)
Genbank accession: BC002637
Immunogen: TRIB2 (AAH02637, 1 a.a. ~ 343 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MNIHRSTPITIARYGRSRNKTQDFEELSSIRSAEPSQSFSPNLGSPSPPETPNLSHCVSCIGKYLLLEPLEGDHVFRAVHLHSGEELVCKVFDISCYQESLAPCFCLSAHSNINQITEIILGETKAYVFFERSYGDMHSFVRTCKKLREEEAARLFYQIASAVAHCHDGGLVLRDLKLRKFIFKDEERTRVKLESLEDAYILRGDDDSLSDKHGCPAYVSPEILNTSGSYSGKAADVWSLGVMLYTMLVGRYPFHDIEPSSLFSKIRRGQFNIPETLSPKAKCLIRSILRREPSERLTSQEILDHPWFSTDFSVSNSAYGAKEVSDQLVPDVNMEENLDPFFN
Protein accession: AAH02637
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00028951-M11-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (63.47 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00028951-M11-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged TRIB2 is 1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re,IP
Shipping condition: Dry Ice

Reviews

Buy TRIB2 monoclonal antibody (M11), clone 1D11 now

Add to cart