TRIB2 monoclonal antibody (M04), clone 1B1 View larger

TRIB2 monoclonal antibody (M04), clone 1B1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TRIB2 monoclonal antibody (M04), clone 1B1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab

More info about TRIB2 monoclonal antibody (M04), clone 1B1

Brand: Abnova
Reference: H00028951-M04
Product name: TRIB2 monoclonal antibody (M04), clone 1B1
Product description: Mouse monoclonal antibody raised against a partial recombinant TRIB2.
Clone: 1B1
Isotype: IgG2b Lambda
Gene id: 28951
Gene name: TRIB2
Gene alias: C5FW|GS3955|TRB2
Gene description: tribbles homolog 2 (Drosophila)
Genbank accession: NM_021643
Immunogen: TRIB2 (NP_067675, 254 a.a. ~ 343 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: FHDIEPSSLFSKIRRGQFNIPETLSPKAKCLIRSILRREPSERLTSQEILDHPWFSTDFSVSNSAYGAKEVSDQLVPDVNMEENLDPFFN
Protein accession: NP_067675
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00028951-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.64 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00028951-M04-3-7-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to TRIB2 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]
Applications: IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab
Shipping condition: Dry Ice
Publications: TRIB2 inhibits Wnt/β-Catenin/TCF4 signaling through its associated Ubiquitin E3 ligases, β-TrCP, COP1 and Smurf1, in liver cancer cells.Xu S, Tong M, Huang J, Zhang Y, Qiao Y, Weng W, Liu W, Wang J, Sun F
FEBS Lett. 2014 Oct 11. pii: S0014-5793(14)00720-0. doi: 10.1016/j.febslet.2014.09.042.

Reviews

Buy TRIB2 monoclonal antibody (M04), clone 1B1 now

Add to cart