Brand: | Abnova |
Reference: | H00028951-M04 |
Product name: | TRIB2 monoclonal antibody (M04), clone 1B1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TRIB2. |
Clone: | 1B1 |
Isotype: | IgG2b Lambda |
Gene id: | 28951 |
Gene name: | TRIB2 |
Gene alias: | C5FW|GS3955|TRB2 |
Gene description: | tribbles homolog 2 (Drosophila) |
Genbank accession: | NM_021643 |
Immunogen: | TRIB2 (NP_067675, 254 a.a. ~ 343 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | FHDIEPSSLFSKIRRGQFNIPETLSPKAKCLIRSILRREPSERLTSQEILDHPWFSTDFSVSNSAYGAKEVSDQLVPDVNMEENLDPFFN |
Protein accession: | NP_067675 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (35.64 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to TRIB2 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml] |
Applications: | IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
Shipping condition: | Dry Ice |
Publications: | TRIB2 inhibits Wnt/β-Catenin/TCF4 signaling through its associated Ubiquitin E3 ligases, β-TrCP, COP1 and Smurf1, in liver cancer cells.Xu S, Tong M, Huang J, Zhang Y, Qiao Y, Weng W, Liu W, Wang J, Sun F FEBS Lett. 2014 Oct 11. pii: S0014-5793(14)00720-0. doi: 10.1016/j.febslet.2014.09.042. |