Brand: | Abnova |
Reference: | H00028862-M01 |
Product name: | IGKV1OR2-108 monoclonal antibody (M01), clone 3A11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant IGKV1OR2-108. |
Clone: | 3A11 |
Isotype: | IgG2a Kappa |
Gene id: | 28862 |
Gene name: | IGKV1OR2-108 |
Gene alias: | IGKV1OR2108|IGO1 |
Gene description: | immunoglobulin kappa variable 1/OR2-108 (non-functional) |
Genbank accession: | X51887.1 |
Immunogen: | IGKV1OR2-108 (CAA36171.1, 1 a.a. ~ 95 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | DIQVTQSPSSLSASVGDRVTITCRASQGISNGLSWYQQKPGQAPTLLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDVATYYCLQDYTTP |
Protein accession: | CAA36171.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged IGKV1OR2-108 is 0.3 ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA |
Shipping condition: | Dry Ice |