IGKV1OR2-108 monoclonal antibody (M01), clone 3A11 View larger

IGKV1OR2-108 monoclonal antibody (M01), clone 3A11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of IGKV1OR2-108 monoclonal antibody (M01), clone 3A11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA

More info about IGKV1OR2-108 monoclonal antibody (M01), clone 3A11

Brand: Abnova
Reference: H00028862-M01
Product name: IGKV1OR2-108 monoclonal antibody (M01), clone 3A11
Product description: Mouse monoclonal antibody raised against a partial recombinant IGKV1OR2-108.
Clone: 3A11
Isotype: IgG2a Kappa
Gene id: 28862
Gene name: IGKV1OR2-108
Gene alias: IGKV1OR2108|IGO1
Gene description: immunoglobulin kappa variable 1/OR2-108 (non-functional)
Genbank accession: X51887.1
Immunogen: IGKV1OR2-108 (CAA36171.1, 1 a.a. ~ 95 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: DIQVTQSPSSLSASVGDRVTITCRASQGISNGLSWYQQKPGQAPTLLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDVATYYCLQDYTTP
Protein accession: CAA36171.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00028862-M01-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged IGKV1OR2-108 is 0.3 ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy IGKV1OR2-108 monoclonal antibody (M01), clone 3A11 now

Add to cart