DLL1 monoclonal antibody (M02), clone 4F9 View larger

DLL1 monoclonal antibody (M02), clone 4F9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DLL1 monoclonal antibody (M02), clone 4F9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about DLL1 monoclonal antibody (M02), clone 4F9

Brand: Abnova
Reference: H00028514-M02
Product name: DLL1 monoclonal antibody (M02), clone 4F9
Product description: Mouse monoclonal antibody raised against a partial recombinant DLL1.
Clone: 4F9
Isotype: IgG2a Kappa
Gene id: 28514
Gene name: DLL1
Gene alias: DELTA1|DL1|Delta
Gene description: delta-like 1 (Drosophila)
Genbank accession: NM_005618
Immunogen: DLL1 (NP_005609, 18 a.a. ~ 109 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: QVWSSGVFELKLQEFVNKKGLLGNRNCCRGGAGPPPCACRTFFRVCLKHYQASVSPEPPCTYGSAVTPVLGVDSFSLPDGGGADSAFSNPIR
Protein accession: NP_005609
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00028514-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.86 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00028514-M02-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged DLL1 is approximately 0.3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy DLL1 monoclonal antibody (M02), clone 4F9 now

Add to cart