CDH19 polyclonal antibody (A01) View larger

CDH19 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CDH19 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about CDH19 polyclonal antibody (A01)

Brand: Abnova
Reference: H00028513-A01
Product name: CDH19 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant CDH19.
Gene id: 28513
Gene name: CDH19
Gene alias: CDH7|CDH7L2
Gene description: cadherin 19, type 2
Genbank accession: NM_021153
Immunogen: CDH19 (NP_066976, 231 a.a. ~ 340 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: GQPGALSGTTSVLIKLSDVNDNKPIFKESLYRLTVSESAPTGTSIGTIMAYDNDIGENAEMDYSIEEDDSQTFDIITNHETQEGIVILKKKVDFEHQNHYGIRAKVKNHH
Protein accession: NP_066976
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00028513-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (38.21 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Monocyte chemotactic protein-1 promotes angiogenesis via a novel transcription factor MCPIP.Niu J, Azfer A, Zhelyabovska O, Fatma S, Kolattukudy PE.
J Biol Chem. 2008 May 23;283(21):14542-51. Epub 2008 Mar 24.

Reviews

Buy CDH19 polyclonal antibody (A01) now

Add to cart