NKIRAS1 monoclonal antibody (M01), clone 2A7 View larger

NKIRAS1 monoclonal antibody (M01), clone 2A7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NKIRAS1 monoclonal antibody (M01), clone 2A7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,S-ELISA,ELISA,WB-Re

More info about NKIRAS1 monoclonal antibody (M01), clone 2A7

Brand: Abnova
Reference: H00028512-M01
Product name: NKIRAS1 monoclonal antibody (M01), clone 2A7
Product description: Mouse monoclonal antibody raised against a partial recombinant NKIRAS1.
Clone: 2A7
Isotype: IgG2a Kappa
Gene id: 28512
Gene name: NKIRAS1
Gene alias: KBRAS1|kappaB-Ras1
Gene description: NFKB inhibitor interacting Ras-like 1
Genbank accession: BC012145
Immunogen: NKIRAS1 (AAH12145, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MGKGCKVVVCGLLSVGKTAILEQLLYGNHTIGMEDCETMEDVYMASVETDRGVKEQLHLYDTRGLQEGVELPKHYFSFADGFVLVYSVNNLESFQRVELL
Protein accession: AAH12145
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00028512-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00028512-M01-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged NKIRAS1 is approximately 0.1ng/ml as a capture antibody.
Applications: IHC-P,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy NKIRAS1 monoclonal antibody (M01), clone 2A7 now

Add to cart