NKIRAS2 monoclonal antibody (M02), clone 2G9 View larger

NKIRAS2 monoclonal antibody (M02), clone 2G9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NKIRAS2 monoclonal antibody (M02), clone 2G9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P,S-ELISA,ELISA,WB-Re

More info about NKIRAS2 monoclonal antibody (M02), clone 2G9

Brand: Abnova
Reference: H00028511-M02
Product name: NKIRAS2 monoclonal antibody (M02), clone 2G9
Product description: Mouse monoclonal antibody raised against a full length recombinant NKIRAS2.
Clone: 2G9
Isotype: IgG1 Kappa
Gene id: 28511
Gene name: NKIRAS2
Gene alias: DKFZp434N1526|KBRAS2|MGC74742|kappaB-Ras2
Gene description: NFKB inhibitor interacting Ras-like 2
Genbank accession: BC007450
Immunogen: NKIRAS2 (AAH07450, 1 a.a. ~ 191 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MGKSCKVVVCGQASVGKTSILEQLLYGNHVVGSEMIETQEDIYVGSIETDRGVREQVRFYDTRGLRDGAELPRHCFSCTDGYVLVYSTDSRESFQRVELLKKEIDKSKDKKEVTIVVLGNKCDLQEQRRVDPDVAQHWAKSEKVKLWEVSVADRRSLLEPFVYLASKMTQPQSKSAFPLSRKNKGSGSLDG
Protein accession: AAH07450
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00028511-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (46.75 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00028511-M02-3-5-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to NKIRAS2 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml]
Applications: WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Estradiol suppresses NF-kappaB activation through coordinated regulation of let-7a and miR-125b in primary human macrophages.Murphy AJ, Guyre PM, Pioli PA.
J Immunol. 2010 May 1;184(9):5029-37. Epub 2010 Mar 29.

Reviews

Buy NKIRAS2 monoclonal antibody (M02), clone 2G9 now

Add to cart