PPP2R3B monoclonal antibody (M14), clone 1F4 View larger

PPP2R3B monoclonal antibody (M14), clone 1F4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PPP2R3B monoclonal antibody (M14), clone 1F4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,IP

More info about PPP2R3B monoclonal antibody (M14), clone 1F4

Brand: Abnova
Reference: H00028227-M14
Product name: PPP2R3B monoclonal antibody (M14), clone 1F4
Product description: Mouse monoclonal antibody raised against a full-length recombinant PPP2R3B.
Clone: 1F4
Isotype: IgG1 Kappa
Gene id: 28227
Gene name: PPP2R3B
Gene alias: NY-REN-8|PPP2R3L|PPP2R3LY|PR48
Gene description: protein phosphatase 2 (formerly 2A), regulatory subunit B'', beta
Genbank accession: BC009032
Immunogen: PPP2R3B (AAH09032, 1 a.a. ~ 176 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MDLDGDGALSMFELEYFYEEQCRRLDSMAIEALPFQDCLCQMLDLVKPRTEGKITLQDLKRCKLANVFFDTFFNIEKYLDHEQKEQISLLRDGDSGGPELSDWEKYAAEEYDILVAEETAGEPWEDGFEAELSPVEQKLSALRSPLAQRPFFEAPSPLGAVDLYEYACGDEDLESL
Protein accession: AAH09032
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00028227-M14-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (45.1 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00028227-M14-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged PPP2R3B is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re,IP
Shipping condition: Dry Ice

Reviews

Buy PPP2R3B monoclonal antibody (M14), clone 1F4 now

Add to cart