Brand: | Abnova |
Reference: | H00028227-M08 |
Product name: | PPP2R3B monoclonal antibody (M08), clone 2E12 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant PPP2R3B. |
Clone: | 2E12 |
Isotype: | IgG2b Kappa |
Gene id: | 28227 |
Gene name: | PPP2R3B |
Gene alias: | NY-REN-8|PPP2R3L|PPP2R3LY|PR48 |
Gene description: | protein phosphatase 2 (formerly 2A), regulatory subunit B'', beta |
Genbank accession: | BC011180 |
Immunogen: | PPP2R3B (AAH11180, 1 a.a. ~ 225 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MIDRIFSGAVTRGRKVQKEGKISYADFVWFLISEEDKKTPTSIEYWFRCMDLDGDGALSMFELEYFYEEQCRRLDSMAIEALPFQDCLCQMLDLVKPRTEGKITLQDLKRCKLANVFFDTFFNIEKYLDHEQKEQISLLRDGDSGGPELSDWEKYAAEEYDILVAEETAGEPWEDGFEAELSPVEQKLSALRSPLAQRPFFEAPSPLGAVDLYEYACGDEDLEPL |
Protein accession: | AAH11180 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (50.49 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged PPP2R3B is 0.3 ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA,WB-Re,IP |
Shipping condition: | Dry Ice |