PPP2R3B monoclonal antibody (M08), clone 2E12 View larger

PPP2R3B monoclonal antibody (M08), clone 2E12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PPP2R3B monoclonal antibody (M08), clone 2E12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re,IP

More info about PPP2R3B monoclonal antibody (M08), clone 2E12

Brand: Abnova
Reference: H00028227-M08
Product name: PPP2R3B monoclonal antibody (M08), clone 2E12
Product description: Mouse monoclonal antibody raised against a full-length recombinant PPP2R3B.
Clone: 2E12
Isotype: IgG2b Kappa
Gene id: 28227
Gene name: PPP2R3B
Gene alias: NY-REN-8|PPP2R3L|PPP2R3LY|PR48
Gene description: protein phosphatase 2 (formerly 2A), regulatory subunit B'', beta
Genbank accession: BC011180
Immunogen: PPP2R3B (AAH11180, 1 a.a. ~ 225 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MIDRIFSGAVTRGRKVQKEGKISYADFVWFLISEEDKKTPTSIEYWFRCMDLDGDGALSMFELEYFYEEQCRRLDSMAIEALPFQDCLCQMLDLVKPRTEGKITLQDLKRCKLANVFFDTFFNIEKYLDHEQKEQISLLRDGDSGGPELSDWEKYAAEEYDILVAEETAGEPWEDGFEAELSPVEQKLSALRSPLAQRPFFEAPSPLGAVDLYEYACGDEDLEPL
Protein accession: AAH11180
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00028227-M08-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (50.49 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00028227-M08-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged PPP2R3B is 0.3 ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA,WB-Re,IP
Shipping condition: Dry Ice

Reviews

Buy PPP2R3B monoclonal antibody (M08), clone 2E12 now

Add to cart