View larger

PPP2R3B purified MaxPab mouse polyclonal antibody (B01P)

Reference:

Condition: New product

Data sheet of PPP2R3B purified MaxPab mouse polyclonal antibody (B01P)

Brand:	Abnova
Reference:	H00028227-B01P
Product name:	PPP2R3B purified MaxPab mouse polyclonal antibody (B01P)
Product description:	Mouse polyclonal antibody raised against a full-length human PPP2R3B protein.
Gene id:	28227
Gene name:	PPP2R3B
Gene alias:	NY-REN-8\|PPP2R3L\|PPP2R3LY\|PR48
Gene description:	protein phosphatase 2 (formerly 2A), regulatory subunit B'', beta
Genbank accession:	BC011180
Immunogen:	PPP2R3B (AAH11180.1, 1 a.a. ~ 225 a.a) full-length human protein.
Immunogen sequence/protein sequence:	MIDRIFSGAVTRGRKVQKEGKISYADFVWFLISEEDKKTPTSIEYWFRCMDLDGDGALSMFELEYFYEEQCRRLDSMAIEALPFQDCLCQMLDLVKPRTEGKITLQDLKRCKLANVFFDTFFNIEKYLDHEQKEQISLLRDGDSGGPELSDWEKYAAEEYDILVAEETAGEPWEDGFEAELSPVEQKLSALRSPLAQRPFFEAPSPLGAVDLYEYACGDEDLEPL
Protein accession:	AAH11180.1
Storage buffer:	In 1x PBS, pH 7.4
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody reactive against mammalian transfected lysate.
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	Western Blot analysis of PPP2R3B expression in transfected 293T cell line (H00028227-T01) by PPP2R3B MaxPab polyclonal antibody. Lane 1: PPP2R3B transfected lysate(24.86 KDa). Lane 2: Non-transfected lysate.
Applications:	WB-Tr
Shipping condition:	Dry Ice