EML4 monoclonal antibody (M02), clone 2F2 View larger

EML4 monoclonal antibody (M02), clone 2F2

H00027436-M02_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of EML4 monoclonal antibody (M02), clone 2F2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about EML4 monoclonal antibody (M02), clone 2F2

Brand: Abnova
Reference: H00027436-M02
Product name: EML4 monoclonal antibody (M02), clone 2F2
Product description: Mouse monoclonal antibody raised against a full-length recombinant EML4.
Clone: 2F2
Isotype: IgG1 Kappa
Gene id: 27436
Gene name: EML4
Gene alias: C2orf2|DKFZp686P18118|ELP120|FLJ10942|FLJ32318|ROPP120
Gene description: echinoderm microtubule associated protein like 4
Genbank accession: BC008685
Immunogen: EML4 (AAH08685, 1 a.a. ~ 62 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MCYTPCKKYTDMNRQFLEKKEHFFKYLGNTALSDQQGVYLRTSVTFGVAMYNEIYNHDTLRW
Protein accession: AAH08685
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00027436-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (32.56 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00027436-M02-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged EML4 is 0.1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy EML4 monoclonal antibody (M02), clone 2F2 now

Add to cart