Brand: | Abnova |
Reference: | H00027436-M02 |
Product name: | EML4 monoclonal antibody (M02), clone 2F2 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant EML4. |
Clone: | 2F2 |
Isotype: | IgG1 Kappa |
Gene id: | 27436 |
Gene name: | EML4 |
Gene alias: | C2orf2|DKFZp686P18118|ELP120|FLJ10942|FLJ32318|ROPP120 |
Gene description: | echinoderm microtubule associated protein like 4 |
Genbank accession: | BC008685 |
Immunogen: | EML4 (AAH08685, 1 a.a. ~ 62 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MCYTPCKKYTDMNRQFLEKKEHFFKYLGNTALSDQQGVYLRTSVTFGVAMYNEIYNHDTLRW |
Protein accession: | AAH08685 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (32.56 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged EML4 is 0.1 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |