Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of MAT2B polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about MAT2B polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00027430-A01 |
| Product name: | MAT2B polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a full-length recombinant MAT2B. |
| Gene id: | 27430 |
| Gene name: | MAT2B |
| Gene alias: | MAT-II|MATIIbeta|MGC12237|Nbla02999|SDR23E1|TGR |
| Gene description: | methionine adenosyltransferase II, beta |
| Genbank accession: | BC005218 |
| Immunogen: | MAT2B (AAH05218, 1 a.a. ~ 323 a.a) full-length recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | MPEMPEDMEQEEVNIPNRRVLVTGATGLLGRAVHKEFQQNNWHAVGCGFRRARPKFEQVNLLDSNAVHHIIHDFQPHVIVHCAAERRPDVVENQPDAASQLNVDASGNLAKEAAAVGAFLIYISSDYVFDGTNPPYREEDIPAPLNLYGKTKLDGEKAVLENNLGAAVLRIPILYGEVEKLEESAVTVMFDKVQFSNKSANMDHWQQRFPTHVKDVATVCRQLAEKRMLDPSIKGTFHWSGNEQMTKYEMACAIADAFNLPSSHLRPITDSPVLGAQRPRNTQLDCSKLETLGIGQRTPFRIGIKESLWPFLIDKRWRQTVFH |
| Protein accession: | AAH05218 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (61.64 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Lentivirus mediated shRNA interference targeting MAT2B induces growth-inhibition and apoptosis in hepatocellular carcinoma.Wang Q, Liu QY, Liu ZS, Qian Q, Sun Q, Pan DY. World J Gastroenterol. 2008 Aug 7;14(29):4633-42. |